PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7317_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 250aa    MW: 27823.7 Da    PI: 6.1737
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7317_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1993153257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r+R+t+t+ ql+ Le+lF +   +ps++++++++++l    ++ e +V++WFqNrRa+ k+
  RrC7317_p1  93 RQRWTPTPLQLQNLERLFDQgIGTPSKQKIKDITDELsqhgQIAEHNVYNWFQNRRARSKR 153
                 89*****************99**************************************97 PP

2Wus_type_Homeobox97.21.3e-3193155365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RWtPtp Q++ Le+l+++G+ tP+k++i++it eL+++G+i ++NV++WFQNr+aR+++kq
         RrC7317_p1  93 RQRWTPTPLQLQNLERLFDQGIGTPSKQKIKDITDELSQHGQIAEHNVYNWFQNRRARSKRKQ 155
                        89***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.97789154IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-1490156IPR009057Homeodomain-like
SMARTSM003892.1E-1191158IPR001356Homeobox domain
SuperFamilySSF466892.82E-1591155IPR009057Homeodomain-like
PfamPF000464.2E-1793153IPR001356Homeobox domain
CDDcd000866.65E-1093155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MMEWDNQQQP NNHHSSNLQG MDVNGGSGSG GMYMRVMTDE QLETLRKQIA IYSTICERLV  60
QMHKTLTSQQ DLAGGRIGGL YADTTIAHKM TGRQRWTPTP LQLQNLERLF DQGIGTPSKQ  120
KIKDITDELS QHGQIAEHNV YNWFQNRRAR SKRKQHGGVG SSSHKNGEGE VETETETLNE  180
KRKRPESLVG LPDGNDNNNG IGTTATTTSP RPEDLCFQSP EMSSDLHFLG VLSNPSISGC  240
DHVEDYDISG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895411e-167AC189541.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH004A18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284087.11e-129hypothetical protein CARUB_v10005217mg
RefseqXP_013595483.11e-130PREDICTED: WUSCHEL-related homeobox 13-like
SwissprotO817881e-127WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A078C6A31e-130A0A078C6A3_BRANA; BnaC07g45680D protein
TrEMBLA0A0D3DHV01e-130A0A0D3DHV0_BRAOL; Uncharacterized protein
TrEMBLR0GXF71e-129R0GXF7_9BRAS; Uncharacterized protein
STRINGscaffold_700564.11e-128(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-103WUSCHEL related homeobox 13